Invitrogen™ Human UNC13B (aa 343-393) Control Fragment Recombinant Protein

Product Code. 30213378

Brand: Invitrogen™ RP104106

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64015 (PA5-64015. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in vesicle maturation during exocytosis as a target of the diacylglycerol second messenger pathway. Is involved in neurotransmitter release by acting in synaptic vesicle priming prior to vesicle fusion and participates in the activity-depending refilling of readily releasable vesicle pool (RRP). Essential for synaptic vesicle maturation in a subset of excitatory/glutamatergic but not inhibitory/GABA-mediated synapses.

Specifications

• Accession Number: O14795
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10497
• Name: Human UNC13B (aa 343-393) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: homolog of rat Munc13 (diacylglycerol-binding); munc13; Munc13-1; Munc13-2; protein unc-13 homolog B; UNC13; unc13 homolog 1; UNC-13 homolog 1; unc-13 homolog A; unc-13 homolog B; unc-13 homolog B (C. elegans); Unc13a; Unc13b; Unc13h1; Unc13h2
• Common Name: UNC13B
• Gene Symbol: UNC13B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PPDLVLQKDHFLGPQESFPEENASSPFTQARAHWIRAVTKVRLQLQEIPDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining