missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182399

Invitrogen™ Human UNC119 (aa 52-93) Control Fragment Recombinant Protein

Product Code. 30182399
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182399

Brand: Invitrogen™ RP98373

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59781 (PA5-59781. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13432
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9094
Name Human UNC119 (aa 52-93) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CRG4; D11Bhm52; hRG4; IMD13; MRG4; POC7; POC7 centriolar protein homolog A; POC7A; Protein unc-119 homolog A; retinal gene 4; retinal protein 4; Rg4; RRG4; Rtg4; Unc119; unc-119 homolog; UNC-119 homolog (C. elegans); unc-119 lipid binding chaperone; Unc119h; Uncl19
Common Name UNC119
Gene Symbol UNC119
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.