Invitrogen™ Human UMODL1 (aa 276-355) Control Fragment Recombinant Protein

Product Code. 30209823

Brand: Invitrogen™ RP103651

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64317 (PA5-64317. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UMODL1 gene ontology annotations related to this gene include adipose tissue development; cellular response to gonadotropin-releasing hormone; multicellular organismal reproductive process; regulation of apoptotic process; regulation of gene expression; regulation of ovarian follicle development; single fertilization.

Specifications

• Accession Number: Q5DID0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 89766
• Name: Human UMODL1 (aa 276-355) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D17Ertd488e; Olfactorin; RGD1566039; Umodl1; uromodulin like 1; uromodulin-like 1
• Common Name: UMODL1
• Gene Symbol: UMODL1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CSGRELCANLEGSYWCVCHQEAPATSPRKLNLEWEDCPPVSDYVVLNVTSDSFQVSWRLNSTQNHTFHVRVYRGMELLRS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining