Invitrogen™ Human ULBP3 (aa 31-94) Control Fragment Recombinant Protein

Product Code. 30204655

Brand: Invitrogen™ RP94828

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (27%), Rat (27%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64083 (PA5-64083. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UL16-binding protein 3 (ULBP3) is an extended member of the MHC class I superfamily. It does not contain the alpha 3 domain and lacks a transmembrane domain. ULBP3 binds and activates the KLRK1/NKG2D receptor and mediates natural killer cell cytotoxicity.

Specifications

• Accession Number: Q9BZM4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79465
• Name: Human ULBP3 (aa 31-94) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: ALCAN-gamma; N2DL3; N2DL-3; NKG2D ligand 3; NKG2D ligand3; NKG2DL3; RAET1N; Retinoic acid early transcript 1 N; UL16 binding protein 3; UL16-binding protein 3; ULBP; ULBP 3; ULBP3
• Common Name: ULBP3
• Gene Symbol: ULBP3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining