Invitrogen™ Human ULBP1 (aa 158-221) Control Fragment Recombinant Protein

Product Code. 30213271

Brand: Invitrogen™ RP107786

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (28%), Rat (28%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111667 (PA5-111667. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ULBP1 is the ligand for the NKG2D receptor, together with at least ULBP2 and ULBP3. ULBPs activate multiple signaling pathways in primary NK cells, resulting in the production of cytokines and chemokines. Binding of ULBPs ligands to NKG2D induces calcium mobilization and activation of the JAK2, STAT5, ERK and PI3K kinase/Akt signal transduction pathway. In CMV infected cells, interacts with soluble CMV glycoprotein UL16. The interaction with UL16 blocked the interaction with the NKG2D receptor, providing a mechanism by which CMV infected cells might escape the immune system. UL16 also causes ULBP1 to be retained in the ER and cis-Golgi apparatus so that it does not reach the cell surface.

Specifications

• Accession Number: Q9BZM6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80329
• Name: Human ULBP1 (aa 158-221) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A430108B07Rik; ALCAN-beta; MULT1; N2DL1; N2DL-1; NKG2D ligand; NKG2D ligand 1; NKG2D ligand1; NKG2DL1; RAET1I; retinoic acid early transcript 1 I; UL16 binding protein 1; UL16-binding protein 1; UL16-binding protein-like transcript 1; ULBP; ULBP 1; ULBP1
• Common Name: ULBP1
• Gene Symbol: ULBP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining