Invitrogen™ Human UHRF2 (aa 290-368) Control Fragment Recombinant Protein

Product Code. 30207585

Brand: Invitrogen™ RP91746

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110919 (PA5-110919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Specifications

• Accession Number: Q96PU4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 115426
• Name: Human UHRF2 (aa 290-368) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310065A22Rik; AI426270; AW214556; D130071B19Rik; E3 ubiquitin-protein ligase UHRF2; Nirf; np95/ICBP90-like RING finger protein; Np95-like ring finger protein; Nuclear protein 97; nuclear zinc finger protein Np97; RING finger protein 107; RING-type E3 ubiquitin transferase UHRF2; RNF107; RP11-472F14.2; TDRD23; ubiquitin like with PHD and ring finger domains 2; ubiquitin-like PHD and RING finger domain-containing protein 2; ubiquitin-like with PHD and ring finger domains 2, E3 ubiquitin protein ligase; ubiquitin-like, containing PHD and RING finger domains 2; ubiquitin-like, containing PHD and RING finger domains, 2; ubiquitin-like-containing PHD and RING finger domains protein 2; UHRF2; URF2
• Common Name: UHRF2
• Gene Symbol: UHRF2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SEGTLNDCKIISVDEIFKIERPGAHPLSFADGKFLRRNDPECDLCGGDPEKKCHSCSCRVCGGKHEPNMQLLCDECNVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining