Invitrogen™ Human UHRF1BP1 (aa 998-1069) Control Fragment Recombinant Protein

Product Code. 30194518

Brand: Invitrogen™ RP94621

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56928 (PA5-56928. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UHRF1BP1 (UHRF1 binding protein 1) is a 1,440 amino acid protein that interacts with UHRF1 and may act as a negative regulator of cell growth. The UHRF1BP1 protein has been identified as a possible risk loci for systemic lupus erythematosus. The UHRF1BP1 gene is conserved in chimpanzee, dog, cow, mouse, rat, chicken, zebrafish and C.elegans, and maps to human chromosome 6p21.31.

Specifications

• Accession Number: Q6BDS2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54887
• Name: Human UHRF1BP1 (aa 998-1069) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110020K19Rik; AA408674; C6orf107; dJ349A12.1; F830021D11Rik; ICBP90; ICBP90 binding protein 1; ICBP90-binding protein 1; mKIAA4127; Ubiquitin-like containing PHD and RING finger domains 1-binding protein 1; UHRF1 (ICBP90) binding protein 1; UHRF1 binding protein 1; UHRF1-binding protein 1; Uhrf1bp1
• Common Name: UHRF1BP1
• Gene Symbol: UHRF1BP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RETAVNGQGELIPLKNIEGELSSAIHMTKDATKEALHATMDLTKEAVSLTKDAFSLGRDRMTSTMHKMLSLP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining