Invitrogen™ Human UHRF1 (aa 207-276) Control Fragment Recombinant Protein

Product Code. 30194332

Brand: Invitrogen™ RP108412

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q96T88
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 29128
• Name: Human UHRF1 (aa 207-276) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Ac2-121; AL022808; E3 ubiquitin-protein ligase UHRF1; fb97f09; FLJ21925; hNP95; Hnp95 Huhrf1; hUHRF1; HuNp95; ICBP90; inverted CCAAT box-binding protein of 90 kDa; Liver regeneration-related protein LRRG126; MGC138707; mUhrf1; Np95; nuclear phosphoprotein 95; nuclear protein; nuclear protein 95; Nuclear zinc finger protein Np95; RING finger protein 106; RING-type E3 ubiquitin transferase UHRF1; RNF106; TDRD22; transcription factor ICBP90; ub; ubiquitin like with PHD and ring finger domains 1; ubiquitin-like PHD and RING finger domain-containing protein 1; ubiquitin-like with PHD and ring finger domains 1; ubiquitin-like, containing PHD and RING finger domains, 1; ubiquitin-like-containing PHD and RING finger domains protein 1; Uhrf1; unm b1115; unm_b1115; wu:fb97f09; zgc:63539
• Common Name: UHRF1
• Gene Symbol: UHRF1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining