Invitrogen™ Human UGT8 (aa 205-311) Control Fragment Recombinant Protein

Product Code. 30195091

Brand: Invitrogen™ RP107455

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111606 (PA5-111606. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UGT8 (UDP-galactose-ceramide galactosyltransferase, 2-hydroxyacylsphingosine 1-beta-galactosyltransferase) is a 541 amino acid, single pass membrane protein of the UDP-glycosyltransferase family. UGT8 is believed to be primarily involved with the metabolism of sphingolipids and galactosylceramide biosynthesis. UGT8 is one of six genes whose elevated expression has been correlated with a significantly increased the risk of lung metastases in breast cancer patients. As such, UGT8 may be a significant index of tumor aggressiveness and a potential marker for the prognostic evaluation of lung metastases in breast cancer. UGT8 is ubiquitously expressed with highest levels found in central and peripheral nervous systems and is up-regulated in breast cancers.

Specifications

• Accession Number: Q16880
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7368
• Name: Human UGT8 (aa 205-311) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2-hydroxyacylsphingosine 1-beta-galactosyltransferase; AI850488; AW455908; ceramide UDP-galactosyltransferase; Cerebroside synthase; Cgt; mCerGT; UDP galactosyltransferase 8; UDP galactosyltransferase 8 A; UDP glycosyltransferase 8; UDP-galactose ceramide galactosyltransferase; UDP-galactose-ceramide galactosyltransferase; UDP-galactose-ceramide galactosyltransferase 8; UDP-galactose-ceramide galactosyltransferase 8 A; UDP-glucuronosyltransferase 8; Ugt4; UGT8; Ugt8a; uridine diphosphate glycosyltransferase 8
• Common Name: UGT8
• Gene Symbol: Ugt8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LGVSFLVLPKYERIMQKYNLLPEKSMYDLVHGSSLWMLCTDVALEFPRPTLPNVVYVGGILTKPASPLPEDLQRWVNGANEHGFVLVSFGAGVKYLSEDIANKLAGA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining