Invitrogen™ Human UGT3A2 (aa 388-428) Control Fragment Recombinant Protein

Product Code. 30201553

Brand: Invitrogen™ RP101857

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63732 (PA5-63732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q3SY77
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 167127
• Name: Human UGT3A2 (aa 388-428) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI313915; PSEC0073; RGD1564365; UDP glucuronosyltransferase 3 family, polypeptide A2; UDP glycosyltransferase 3 family, polypeptide A2; UDP glycosyltransferase family 3 member A2; UDP glycosyltransferases 3 family, polypeptide A2; UDP-glucuronosyltransferase 3A2; UDPGT 3A2; Ugt3a2; UNQ842/PRO1780
• Common Name: UGT3A2
• Gene Symbol: UGT3A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: IPLFGDQPENMVRVEAKKFGVSIQLKKLKAETLALKMKQIM
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining