missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198826

Invitrogen™ Human UGCG (aa 34-140) Control Fragment Recombinant Protein

Product Code. 30198826
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198826

Brand: Invitrogen™ RP93000

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54986 (PA5-54986. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May serve as a 'flippase' as well as a glucosyltransferase that transfers glucose to ceramide. It Catalyzes; UDP-glucose + Nacylsphingosine = UDP + D-glucosyl-N-acylsphingosine. Ceramide Glycosyltransferase is the first step in the Glycosphingolipid synthesis; first glycosylation step. Glucosylceramide synthase (GlcT) and lactosylceramide synthase (GalT) are key enzymes for the synthesis of major glycosphingolipids of vertebrates.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q16739
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7357
Name Human UGCG (aa 34-140) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AU043821; C80537; cb539; Ceramide glucosyltransferase; ectoplacental cone, invasive trophoblast giant cells, extraembryonic ectoderm and chorion sequence 21; Epcs21; GCS; GlcT; GLCT1; GLCT-1; glucosylceramide synthase; hypothetical protein LOC553944; sb:cb539; UDP-glucose ceramide glucosyltransferase; UDP-glucose:ceramide glycosyltransferase; UDP-glucose:N-acylsphingosine D-glucosyltransferase; Ugcg; Ugcgl; zgc:112506
Common Name UGCG
Gene Symbol UGCG
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPGYEVAKYDLI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.