Invitrogen™ Human UFSP2 (aa 120-201) Control Fragment Recombinant Protein

Product Code. 30210688

Brand: Invitrogen™ RP95830

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59019 (PA5-59019. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin-fold modifier 1 (Ufm1)-specific protease 2 (UfSP2) is a cysteine protease that is responsible for the release of Ufm1 from Ufm1-conjugated cellular proteins, as well as for the generation of mature Ufm1 from its precursor.

Specifications

• Accession Number: Q9NUQ7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55325
• Name: Human UFSP2 (aa 120-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810047C23Rik; BHD; C4orf20; RGD1311161; UFM1 specific peptidase 2; UFM1-specific peptidase 2; ufm1-specific protease 2; UfSP2
• Common Name: UFSP2
• Gene Symbol: Ufsp2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MLEMSTSLAAVTPIIERESGGHHYVNMTLPVDAVISVAPEETWGKVRKLLVDAIHNQLTDMEKCILKYMKGTSIVVPEPLHF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining