Invitrogen™ Human UCMA (aa 89-138) Control Fragment Recombinant Protein

Product Code. 30199723

Brand: Invitrogen™ RP100763

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61295 (PA5-61295. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UCMA is a gene that encodes for a protein that is specific to chondrocytes and highly charged. This protein is expressed abundantly in the upper immature zone of fetal and juvenile epiphyseal cartilage. The encoded protein undergoes proteolytic processing to generate a mature protein that is secreted into the extracellular matrix. The glutamic acid residues in the protein undergo gamma carboxylation in a vitamin K-dependent manner. Undercarboxylation of the protein has been associated with osteoarthritis in humans. Alternative splicing of the gene results in multiple transcript variants that encode different isoforms. UCMA is also associated with diseases such as Osteoarthritis and Poland Syndrome.

Specifications

• Accession Number: Q8WVF2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 221044
• Name: Human UCMA (aa 89-138) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110017I16Rik; AW121955; C10orf49; Gla-rich protein; GRP; GRP/UCMA; RGD1308977; Ucma; ucma {ECO:0000250; Ucma-C; UniProtKB:Q14BU0}; Unique cartilage matrix-associated protein; unique cartilage matrix-associated protein {ECO:0000250; Unique cartilage matrix-associated protein C-terminal fragment; upper zone of growth plate and cartilage matrix associated; upper zone of growth plate and cartilage matrix associated protein
• Common Name: UCMA
• Gene Symbol: UCMA
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining