Invitrogen™ Human UCKL1 (aa 412-541) Control Fragment Recombinant Protein

Product Code. 30203302

Brand: Invitrogen™ RP88609

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52092 (PA5-52092. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Uridine kinase is a key enzyme in the pyrimidine salvage pathway of all mammalian cells. URKL1 (uridine kinase-like 1) is highly similar in structure and sequence to uridine kinase.

Specifications

• Accession Number: Q9NWZ5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54963
• Name: Human UCKL1 (aa 412-541) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110007H10Rik; F538; RGD1565465; UCK1L; UCK1-LIKE; Uckl1; uridine kinase-like 1; uridine-cytidine kinase 1 like 1; uridine-cytidine kinase 1-like 1; uridine-cytidine kinase-like 1; URKL1
• Common Name: UCKL1
• Gene Symbol: Uckl1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AVCKDVRIGTILIQTNQLTGEPELHYLRLPKDISDDHVILMDCTVSTGAAAMMAVRVLLDHDVPEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLFRIIPGIGNFGDRYFGTDAVPDGSDE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining