Invitrogen™ Human UCH37 (aa 100-155) Control Fragment Recombinant Protein

Product Code. 30200906

Brand: Invitrogen™ RP88752

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52223 (PA5-52223. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UCH-L5 (ubiquitin carboxyl-terminal hydrolase isozyme L5), also known as UCH37, is a 329 amino acid protein that functions to edit polyubiquinated protein substrates. Since UCH-L5 has the potential to rescue ubiquinated proteins, including oncogenic proteins, from proteasomal degradation, it is likely that deregulation of UCH-L5 may affect tumor growth. Through associations with Smad7, UHC-L5 can dramatically upregulate TGFβ-dependent gene expression by de-ubiquinating and stabilizing TGFβ RI. Also, since overexpression of UCH-L5 and other deubiquitinating enzymes has been observed in many cancer cell lines, inhibition of these proteins may be of some interest in designing therapies for cancer treatment. There are four isoforms of UCH-L5 that exist as a result of alternative splicing events.

Specifications

• Accession Number: Q9Y5K5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51377
• Name: Human UCH37 (aa 100-155) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830413B11Rik; AD-019; CGI-70; INO80 complex subunit R; INO80R; ubiquitin carboxyl-terminal esterase L5; ubiquitin carboxyl-terminal hydrolase isozyme L5; ubiquitin carboxyl-terminal hydrolase L5; ubiquitin C-terminal hydrolase 37; ubiquitin C-terminal hydrolase L5; ubiquitin C-terminal hydrolase UCH37; ubiquitin thioesterase L5; UCH37; Uchl5; UCH-L5
• Common Name: UCH37
• Gene Symbol: UCHL5
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDTKT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining