Invitrogen™ Human UBXN8 (aa 63-133) Control Fragment Recombinant Protein

Product Code. 30207511

Brand: Invitrogen™ RP108117

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67460 (PA5-67460. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Involved in endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins, possibly by tethering VCP to the endoplasmic reticulum membrane. May play a role in reproduction.

Specifications

• Accession Number: O00124
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7993
• Name: Human UBXN8 (aa 63-133) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D8S2298E; REP8; Rep-8 protein; Reproduction 8 protein; Reproduction/chromosome 8; UBX domain protein 8; UBX domain-containing protein 6; UBX domain-containing protein 8; UBXD6; UBXN8
• Common Name: UBXN8
• Gene Symbol: UBXN8
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSPQVYLKEEEEKNEKRQKLVRKKQQEAQGEKASRYIENVLKPHQEMKLRKLEERFYQMTGEAWKLSSGHK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining