Invitrogen™ Human UBXN7 (aa 95-194) Control Fragment Recombinant Protein

Product Code. 30197206

Brand: Invitrogen™ RP100194

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61972 (PA5-61972. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin-binding adapter that links a subset of NEDD8-associated cullin ring ligases (CRLs) to the segregase VCP/p97, to regulate turnover of their ubiquitination substrates.

Specifications

• Accession Number: O94888
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26043
• Name: Human UBXN7 (aa 95-194) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: A630090P18; AI196514; KIAA0794; mKIAA0794; UBX domain containing 7; UBX domain protein 7; UBX domain-containing protein 7; Ubxd7; UBXN7
• Common Name: UBXN7
• Gene Symbol: UBXN7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining