missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBXN2B (aa 10-80) Control Fragment Recombinant Protein

Product Code. 30199016
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199016

Brand: Invitrogen™ RP100343

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60969 (PA5-60969. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UBXD2B (UBX domain-containing protein 2B), also known as NSFL1 cofactor p37 and p97 cofactor p37, is a 331 amino acid protein that contains one UBX domain and one SEP domain. UBXN2B is required for ER and Golgi biogenesis and also plays a role in their maintenance during interphase, as well as their reassembly at the end of mitosis. Through interaction with VCP, UBXN2B forms a complex that has membrane fusion activity. Adapter protein required for Golgi and endoplasmic reticulum biogenesis. Involved in Golgi and endoplasmic reticulum maintenance during interphase and in their reassembly at the end of mitosis. The complex formed with VCP has membrane fusion activity; membrane fusion activity requires USO1-GOLGA2 tethering and BET1L. VCPIP1 is also required, but not its deubiquitinating activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14CS0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 137886
Name Human UBXN2B (aa 10-80) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias NSFL1 cofactor p37; p37; p97 cofactor p37; UBX domain protein 2 B; UBX domain-containing protein 2 B; UBXN2B
Common Name UBXN2B
Gene Symbol UBXN2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLNIVRPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.