Invitrogen™ Human UBXN2B (aa 10-80) Control Fragment Recombinant Protein

Product Code. 30199016

Brand: Invitrogen™ RP100343

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60969 (PA5-60969. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UBXD2B (UBX domain-containing protein 2B), also known as NSFL1 cofactor p37 and p97 cofactor p37, is a 331 amino acid protein that contains one UBX domain and one SEP domain. UBXN2B is required for ER and Golgi biogenesis and also plays a role in their maintenance during interphase, as well as their reassembly at the end of mitosis. Through interaction with VCP, UBXN2B forms a complex that has membrane fusion activity. Adapter protein required for Golgi and endoplasmic reticulum biogenesis. Involved in Golgi and endoplasmic reticulum maintenance during interphase and in their reassembly at the end of mitosis. The complex formed with VCP has membrane fusion activity; membrane fusion activity requires USO1-GOLGA2 tethering and BET1L. VCPIP1 is also required, but not its deubiquitinating activity.

Specifications

• Accession Number: Q14CS0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 137886
• Name: Human UBXN2B (aa 10-80) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: NSFL1 cofactor p37; p37; p97 cofactor p37; UBX domain protein 2 B; UBX domain-containing protein 2 B; UBXN2B
• Common Name: UBXN2B
• Gene Symbol: UBXN2B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GEQERRSSGPRPPSARDLQLALAELYEDEVKCKSSKSNRPKATVFKSPRTPPQRFYSSEHEYSGLNIVRPS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining