Invitrogen™ Human UBXD5 (aa 403-485) Control Fragment Recombinant Protein

Product Code. 30209893

Brand: Invitrogen™ RP94323

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55914 (PA5-55914. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein with a divergent C-terminal UBX domain. The homologous protein in the rat interacts with members of the Rnd subfamily of Rho GTPases at the cell periphery through its C-terminal region. It also interacts with several heterotrimeric G proteins through their G-alpha subunits and promotes Rho GTPase activation. It is proposed to serve a bidirectional role in the promotion and inhibition of Rho activity through upstream signaling pathways. The 3' coding sequence of this gene contains a polymoprhic region of 24 nt tandem repeats. Several transcripts containing between 1.5 and five repeat units have been reported. Multiple transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: Q5T124
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 91544
• Name: Human UBXD5 (aa 403-485) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930506L07Rik; COA-1; colorectal tumor-associated antigen COA-1; colorectal tumor-associated antigen-1; D4Bwg1540e; PP2243; Soc; SOCI; Socius; UBX domain containing 5; UBX domain protein 11; UBX domain-containing protein 11; UBX domain-containing protein 5; UBXD5; Ubxn11
• Common Name: UBXD5
• Gene Symbol: UBXN11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SENGEQAFLLMMQPDNTIGDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining