missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBR4 (aa 2301-2430) Control Fragment Recombinant Protein

Product Code. 30202255
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202255

Brand: Invitrogen™ RP90748

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54315 (PA5-54315. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Together with clathrin, forms meshwork structures involved in membrane morphogenesis and cytoskeletal organization. Regulates integrin-mediated signaling. May play a role in activation of FAK in response to cell-matrix interactions. Mediates ubiquitination of ACLY, leading to its subsequent degradation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5T4S7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23352
Name Human UBR4 (aa 2301-2430) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1810009A16Rik; 600 kDa retinoblastoma protein-associated factor; A930005E13Rik; D930005K06Rik; E3 ubiquitin-protein ligase UBR4; Gm1032; Gm1666; KIAA0462; KIAA1307; mKIAA0462; N28143; N-recognin-4; p600; Rbaf600; retinoblastoma-associated factor 600; retinoblastoma-associated factor 600-like protein; retinoblastoma-associated factor of 600 kDa; RING-type E3 ubiquitin transferase UBR4; ubiquitin protein ligase E3 component n-recognin 4; UBR4; Zinc finger UBR1-type protein 1; zinc finger, UBR1 type 1; ZUBR1
Common Name UBR4
Gene Symbol UBR4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADKKLNLFIGASVDPAGVTMIDAVKIYGKTKEQF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.