Invitrogen™ Human UBR4 (aa 2301-2430) Control Fragment Recombinant Protein

Product Code. 30202255

Brand: Invitrogen™ RP90748

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54315 (PA5-54315. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Together with clathrin, forms meshwork structures involved in membrane morphogenesis and cytoskeletal organization. Regulates integrin-mediated signaling. May play a role in activation of FAK in response to cell-matrix interactions. Mediates ubiquitination of ACLY, leading to its subsequent degradation.

Specifications

• Accession Number: Q5T4S7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 23352
• Name: Human UBR4 (aa 2301-2430) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810009A16Rik; 600 kDa retinoblastoma protein-associated factor; A930005E13Rik; D930005K06Rik; E3 ubiquitin-protein ligase UBR4; Gm1032; Gm1666; KIAA0462; KIAA1307; mKIAA0462; N28143; N-recognin-4; p600; Rbaf600; retinoblastoma-associated factor 600; retinoblastoma-associated factor 600-like protein; retinoblastoma-associated factor of 600 kDa; RING-type E3 ubiquitin transferase UBR4; ubiquitin protein ligase E3 component n-recognin 4; UBR4; Zinc finger UBR1-type protein 1; zinc finger, UBR1 type 1; ZUBR1
• Common Name: UBR4
• Gene Symbol: UBR4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VEFGGNDLLQVYNAQQIKHRLNSTGMYVANTKPGGFTIEISNNNSTMVMTGMRIQIGTQAIERAPSYIEIFGRTMQLNLSRSRWFDFPFTREEALQADKKLNLFIGASVDPAGVTMIDAVKIYGKTKEQF
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining