Invitrogen™ Human UBL4A (aa 23-154) Control Fragment Recombinant Protein

Product Code. 30200185

Brand: Invitrogen™ RP92186

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51974 (PA5-51974. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UBL4A is a component of the BAT3 complex, a multiprotein complex involved in the post-translational delivery of tail-anchored (TA) membrane proteins to the endoplasmic reticulum membrane. UBL4A is the TA membrane proteins, also named type II transmembrane proteins, contain a single C-terminal transmembrane region. The complex acts by facilitating TA proteins capture by ASNA1/TRC40: it is recruited to ribosomes synthesizing membrane proteins, interacts with the transmembrane region of newly released TA proteins, and transfers them to ASNA1/TRC40 for targeting.

Specifications

• Accession Number: P11441
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8266
• Name: Human UBL4A (aa 23-154) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: D x 254 E; DXHXS254E; DXS254E; DXS254Eh; G6PD; GDX; GET5; housekeeping protein DXS254E; hypothetical protein LOC504533; MDY2; RGD1563983; TMA24; ubiquitin like 4 A; ubiquitin-like 4; ubiquitin-like 4 A; ubiquitin-like protein 4 A; Ubiquitin-like protein GDX; UBL4; UBL4A
• Common Name: UBL4A
• Gene Symbol: UBL4A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VSTLKQLVSEKLNVPVRQQRLLFKGKALADGKRLSDYSIGPNSKLNLVVKPLEKVLLEEGEAQRLADSPPPQVWQLISKVLARHFSAADASRVLEQLQRDYERSLSRLTLDDIERLASRFLHPEVTETMEKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining