Invitrogen™ Human UBL3 (aa 60-117) Control Fragment Recombinant Protein

Product Code. 30182496

Brand: Invitrogen™ RP97934

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63614 (PA5-63614. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin is a 77 amino acid protein that targets proteins for degradation by the 26S proteasome. Ubiquitin-like proteins are not directly involved in protein degradation, but appear to have many mechanistic similarities with the ubiquitin pathway. UBL3 (ubiquitin-like protein 3), also known as membrane-anchored ubiquitin-fold protein (MUB) or PNSC1, is a 117 amino acid membrane protein belonging to the ubiquitin-like family. Highly conserved between species, UBL3 contains two potential N-glycosylation sites, a potential protein kinase C phosphorylation site, and a potential C-terminal prenylation site. The gene encoding UBL3 is localized to chromosome 13q12. 3.

Specifications

• Accession Number: O95164
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5412
• Name: Human UBL3 (aa 60-117) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW108023; HCG; HCG-1; hsMUB; Membrane-anchored ubiquitin-fold protein; mmMUB; MUB; PNSC1; Protein HCG-1; ubiquitin like 3; ubiquitin-like 3; ubiquitin-like protein 3; Ubl3; Unknown (protein for MGC:128515)
• Common Name: UBL3
• Gene Symbol: UBL3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining