Invitrogen™ Human Ubiquitin B (aa 76-111) Control Fragment Recombinant Protein

Product Code. 30199772

Brand: Invitrogen™ RP104445

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin is a highly conserved protein of about 8.5 kDa molecular weight, which has an ATP dependent role in the targeting of proteins for proteolytic degradation. To perform this function, the protein to be degraded is first covalently attached to the C terminus of ubiquitin, and the ubiquitinated complex is then recognized by a complex of degradative enzymes. Interestingly, ubiquitin also becomes covalently bonded to many types of pathological inclusions, which appear to be resistant to normal degradation. Therefore, ubiquitin antibodies are very useful for studies of these inclusions. For example, the neurofibrillary tangles and paired helical filaments diagnostic of Alzheimer's disease, Lewy bodies seen in Parkinson's disease, and Pick bodies found in Pick's disease are all heavily ubiquitinated and can be readily visualized with ubiquitin antibodies.

Specifications

• Accession Number: P0CG47
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7314
• Name: Human Ubiquitin B (aa 76-111) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AL033289; epididymis secretory protein Li 50; HEL-S-50; HUBCEP52; im:6892314; im:6892314 protein; MGC127041; polyubiquitin; polyubiquitin B; polyubiquitin-B; RPL40; Rps27a; si:ch211-202a12.3; Uba52; Ubb; Ubb2; UBC; Ubi-p63E; Ubiquitin; ubiquitin B; ubiquitin C; Ubiquitin-related; zgc:172187; zUBC
• Common Name: Ubiquitin B
• Gene Symbol: UBB
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining