missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Ubiquitin B (aa 76-111) Control Fragment Recombinant Protein

Product Code. 30199772
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199772

Brand: Invitrogen™ RP104445

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Ubiquitin is a highly conserved protein of about 8.5 kDa molecular weight, which has an ATP dependent role in the targeting of proteins for proteolytic degradation. To perform this function, the protein to be degraded is first covalently attached to the C terminus of ubiquitin, and the ubiquitinated complex is then recognized by a complex of degradative enzymes. Interestingly, ubiquitin also becomes covalently bonded to many types of pathological inclusions, which appear to be resistant to normal degradation. Therefore, ubiquitin antibodies are very useful for studies of these inclusions. For example, the neurofibrillary tangles and paired helical filaments diagnostic of Alzheimer's disease, Lewy bodies seen in Parkinson's disease, and Pick bodies found in Pick's disease are all heavily ubiquitinated and can be readily visualized with ubiquitin antibodies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P0CG47
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7314
Name Human Ubiquitin B (aa 76-111) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AL033289; epididymis secretory protein Li 50; HEL-S-50; HUBCEP52; im:6892314; im:6892314 protein; MGC127041; polyubiquitin; polyubiquitin B; polyubiquitin-B; RPL40; Rps27a; si:ch211-202a12.3; Uba52; Ubb; Ubb2; UBC; Ubi-p63E; Ubiquitin; ubiquitin B; ubiquitin C; Ubiquitin-related; zgc:172187; zUBC
Common Name Ubiquitin B
Gene Symbol UBB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.