missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198656

Invitrogen™ Human UBE2V1 (aa 107-142) Control Fragment Recombinant Protein

Product Code. 30198656
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198656

Brand: Invitrogen™ RP105625

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65767 (PA5-65767. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The TMEM189-UEV mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring TMEM189 and UBE2V1 genes. Ubiquitin-conjugating E2 enzyme variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein produced by this transcript has UEV1 B domains but the protein is localized to the cytoplasm rather than to the nucleus. The significance of this co-transcribed mRNA and the function of its protein product has not yet been determined.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q13404
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7335
Name Human UBE2V1 (aa 107-142) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0610011J09Rik; AI256840; CIR1; CROC1; CROC-1; CROC1B; CROC-1 B; CROC-1 UBE2V; D7Bwg1382e; DJ1185N5.1.3; DNA-binding protein; KUA-UEV; P/OKcl0.19; TRAF6-regulated IKK activator 1 beta Uev1A; UBE2V; Ube2v1; ubiquitin conjugating enzyme E2 V1; ubiquitin conjugating enzyme E2 variant 1; ubiquitin-conjugating enzyme E2 variant 1; UEV1; UEV-1; UEV1A; UEV-1 CIR1
Common Name UBE2V1
Gene Symbol Ube2v1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.