missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198764

Invitrogen™ Human UBE2L6 (aa 24-146) Control Fragment Recombinant Protein

Product Code. 30198764
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198764

Brand: Invitrogen™ RP102070

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51895 (PA5-51895. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to function in the E6/E6-ap-induced ubiquitination of p53.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O14933
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9246
Name Human UBE2L6 (aa 24-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810489I21Rik; E2 ubiquitin conjugating enzyme; E2 ubiquitin-conjugating enzyme L6; MGC40331; retinoic acid induced gene B protein; retinoic acid-induced gene B protein; RIG-B; Ubce8; UBCH8; Ubcm8; UBE2L6; Ubiquitin carrier protein L6; ubiquitin conjugating enzyme E2 L6; ubiquitin conjugating enzyme E2L 6; Ubiquitin/ISG15-conjugating enzyme E2 L6; ubiquitin-conjugating enzyme 8; ubiquitin-conjugating enzyme E2L 6; Ubiquitin-protein ligase L6
Common Name UBE2L6
Gene Symbol UBE2L6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.