missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBE2L6 (aa 24-146) Control Fragment Recombinant Protein

Product Code. 30198764
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198764

Brand: Invitrogen™ RP102070

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51895 (PA5-51895. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). UBE2L6 is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to function in the E6/E6-ap-induced ubiquitination of p53.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O14933
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9246
Name Human UBE2L6 (aa 24-146) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810489I21Rik; E2 ubiquitin conjugating enzyme; E2 ubiquitin-conjugating enzyme L6; MGC40331; retinoic acid induced gene B protein; retinoic acid-induced gene B protein; RIG-B; Ubce8; UBCH8; Ubcm8; UBE2L6; Ubiquitin carrier protein L6; ubiquitin conjugating enzyme E2 L6; ubiquitin conjugating enzyme E2L 6; Ubiquitin/ISG15-conjugating enzyme E2 L6; ubiquitin-conjugating enzyme 8; ubiquitin-conjugating enzyme E2L 6; Ubiquitin-protein ligase L6
Common Name UBE2L6
Gene Symbol UBE2L6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis