Invitrogen™ Human UBE2J1 (aa 159-283) Control Fragment Recombinant Protein

Product Code. 30206492

Brand: Invitrogen™ RP102068

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51947 (PA5-51947. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is located in the membrane of the endoplasmic reticulum and may contribute to quality control ER-associated degradation by the ubiquitin-proteasome system.

Specifications

• Accession Number: Q9Y385
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51465
• Name: Human UBE2J1 (aa 159-283) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 0710008M05Rik; 1110030I22Rik; CGI-76; E2 ubiquitin-conjugating enzyme J1; HSPC153; HSPC205; HSU93243; HsUBC6e; MGC12555; Ncube; NCUBE1; NCUBE-1; non-canonical ubiquitin conjugating enzyme 1; non-canonical ubiquitin-conjugating enzyme 1; UBC6; UBC6E; Ubc6p; Ube2j1; ubiquitin conjugating enzyme E2 J1; ubiquitin conjugating enzyme E2, J1; ubiquitin-conjugating enzyme E2 J1; ubiquitin-conjugating enzyme E2, J1; ubiquitin-conjugating enzyme E2, J1 (UBC6 homolog, yeast); ubiquitin-conjugating enzyme E2, J1, U; ubiquitin-conjugating enzyme E2J 1; yeast ubiquitin-conjugating enzyme UBC6 homolog E; zgc:63554
• Common Name: UBE2J1
• Gene Symbol: Ube2j1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESDLNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSMSPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHTD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining