Invitrogen™ Human UBE2G1 (aa 110-158) Control Fragment Recombinant Protein

Product Code. 30210718

Brand: Invitrogen™ RP100554

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62212 (PA5-62212. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2G1 is a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 98-100% sequence identity with the zebrafish, frog, rat and mouse counterparts, which indicates that this enzyme is highly conserved in eukaryotes.

Specifications

• Accession Number: P62253
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7326
• Name: Human UBE2G1 (aa 110-158) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700059C12Rik; AI256795; AU014992; AW552068; D130023C12Rik; E2 ubiquitin-conjugating enzyme G1; E217K; Ubc7; UBE2G; UBE2G1; ubiqu; Ubiquitin carrier protein G1; ubiquitin conjugating enzyme E2 G1; ubiquitin conjugating enzyme E2G 1; ubiquitin-conjugating enzyme E2 G1; Ubiquitin-conjugating enzyme E2 G1, N-terminally processed; ubiquitin-conjugating enzyme E2G 1; ubiquitin-conjugating enzyme E2G 1 (homologous to C. elegans UBC7); ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans); ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, yeast); ubiquitin-conjugating enzyme UBC7; ubiquitin-protein ligase G1
• Common Name: UBE2G1
• Gene Symbol: UBE2G1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining