missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBASH3A (aa 396-464) Control Fragment Recombinant Protein

Product Code. 30200837
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200837

Brand: Invitrogen™ RP109879

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144832 (PA5-144832. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TULA (T cell ubiquitin ligand, UBASH3A, ubiquitin associated and SH3 domain containing A), STS-2 or CLIP4, is a 661 amino acid protein that localizes to both the nucleus and the cytoplasm and contains one SH3 domain and one UBA domain. Expressed at high levels in thymus, bone marrow, spleen and peripheral blood leukocytes, TULA exists as either a homodimer or a homo-oligomer that interferes with the degradation of receptor-type tyrosine kinases and promotes the accumulation of activated receptors on the cell surface. Additionally, TULA is part of an EGFR- and Cbl-containing complex that interacts with ubiquitinated proteins. The gene encoding TULA, which maps to human chromosome 21, may be involved in the pathogenesis of type I diabetes. Multiple isoforms of TULA are produced due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P57075
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 53347
Name Human UBASH3A (aa 396-464) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5830413C03Rik; C330001M22; Cbl-interacting protein 4; CLIP4; STS2; Sts-2; Suppressor of T-cell receptor signaling 2; T-cell ubiquitin ligand 1; T-cell ubiquitin ligand protein; TULA; TULA1; TULA-1; Ubash3a; ubiquitin associated and SH3 domain containing A; ubiquitin associated and SH3 domain containing, A; ubiquitin-associated and SH3 domain-containing protein A
Common Name UBASH3A
Gene Symbol UBASH3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KSVLVVRHGERVDQIFGKAWLQQCSTPDGKYYRPDLNFPCSLPRRSRGIKDFENDPPLSSCGIFQSRIA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.