Invitrogen™ Human UBASH3A (aa 268-351) Control Fragment Recombinant Protein

Product Code. 30197914

Brand: Invitrogen™ RP95890

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111061 (PA5-111061. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TULA (T cell ubiquitin ligand, UBASH3A, ubiquitin associated and SH3 domain containing A), STS-2 or CLIP4, is a 661 amino acid protein that localizes to both the nucleus and the cytoplasm and contains one SH3 domain and one UBA domain. Expressed at high levels in thymus, bone marrow, spleen and peripheral blood leukocytes, TULA exists as either a homodimer or a homo-oligomer that interferes with the degradation of receptor-type tyrosine kinases and promotes the accumulation of activated receptors on the cell surface. Additionally, TULA is part of an EGFR- and Cbl-containing complex that interacts with ubiquitinated proteins. The gene encoding TULA, which maps to human chromosome 21, may be involved in the pathogenesis of type I diabetes. Multiple isoforms of TULA are produced due to alternative splicing events.

Specifications

• Accession Number: P57075
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 53347
• Name: Human UBASH3A (aa 268-351) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830413C03Rik; C330001M22; Cbl-interacting protein 4; CLIP4; STS2; Sts-2; Suppressor of T-cell receptor signaling 2; T-cell ubiquitin ligand 1; T-cell ubiquitin ligand protein; TULA; TULA1; TULA-1; Ubash3a; ubiquitin associated and SH3 domain containing A; ubiquitin associated and SH3 domain containing, A; ubiquitin-associated and SH3 domain-containing protein A
• Common Name: UBASH3A
• Gene Symbol: UBASH3A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LYSRDMRFVHYQTLRALFQYKPQNVDELTLSPGDYIFVDPTQQDEASEGWVIGISQRTGCRGFLPENYTDRASESDTWVKHRMY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining