missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBAP2L (aa 1018-1088) Control Fragment Recombinant Protein

Product Code. 30206967
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30206967

Brand: Invitrogen™ RP94295

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57141 (PA5-57141. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NICE4, also known as UBAP2L (Ubiquitin-associated protein 2-like) orKIAA0144, is a 1,087 amino acid protein that is ubiquitously expressed. Phosphorylated upon DNA damage, NICE4 contains one UBA domain and is expressed as 4 isoforms produced by alternative splicing events. The gene that encodes NICE4 maps to human chromosome 1. Chromosome 1 is the largest human chromosome spanning about 260 million base pairs and making up 8% of the human genome. There are about 3,000 genes on chromosome 1, and considering the great number of genes there are also a large number of diseases associated with chromosome 1. Notably, the rare aging disease Hutchinson-Gilford progeria is associated with the LMNA gene which encodes Lamin A. When defective, the LMNA gene product can build up in the nucleus and cause characteristic nuclear blebs. The mechanism of rapidly enhanced aging is unclear and is a topic of continuing exploration. The MUTYH gene is located on chromosome 1 and is partially responsible for familial adenomatous polyposis. Stickler syndrome, Parkinsons, Gaucher disease and Usher syndrome are also associated with chromosome 1.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14157
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9898
Name Human UBAP2L (aa 1018-1088) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 3110083O19Rik; 4932431F02Rik; A430103N23Rik; Atp8b2; Atpase, class I, type 8 B, member 2; C77168; EP1; KIAA0144; mKIAA0144; NICE4; NICE-4; Nice-4 protein homolog; Protein NICE-4; Ubap2l; ubiquitin associated protein 2 like; ubiquitin associated protein 2-like; ubiquitin-associated protein 2-like
Common Name UBAP2L
Gene Symbol UBAP2L
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PINPATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQTGSGQRSQTSSIPQK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.