missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human UBA3 (aa 330-426) Control Fragment Recombinant Protein

Product Code. 30213326
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213326

Brand: Invitrogen™ RP96360

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TBC4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9039
Name Human UBA3 (aa 330-426) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A830034N06Rik; AI256736; AI848246; AW546539; DKFZp566J164; hUBA3; MGC22384; NAE2; NEDD8-activating enzyme E1 catalytic subuni-like protein; NEDD8-activating enzyme E1 catalytic subunit; NEDD8-activating enzyme E1 subunit 2; NEDD8-activating enzyme E1C; Nedd8-activating enzyme hUba3; Uba3; UBA3, ubiquitin-activating enzyme E1 homolog; UBE1C; ubiquitin like modifier activating enzyme 3; ubiquitin-activating enzyme 3; Ubiquitin-activating enzyme E1C; ubiquitin-activating enzyme E1C (homologous to yeast UBA3); ubiquitin-activating enzyme E1C (UBA3 homolog, yeast); ubiquitin-like modifier activating enzyme 3; ubiquitin-like modifier-activating enzyme 3; Unknown (protein for MGC:140052); wu:fb75e04; wu:fc37b11; zgc:55528
Common Name UBA3
Gene Symbol Uba3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KIATSAYIPLNNYLVFNDVDGLYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.