missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human U2AF2 (aa 255-346) Control Fragment Recombinant Protein

Product Code. 30182856
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30182856

Brand: Invitrogen™ RP98848

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83667 (PA5-83667. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

U2 auxiliary factor (U2AF), comprised of a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the U2AF large subunit which contains a sequence-specific RNA-binding region with 3 RNA recognition motifs and an Arg/Ser-rich domain necessary for splicing. The large subunit binds to the polypyrimidine tract of introns early during spliceosome assembly. Multiple transcript variants have been detected for this gene, but the full-length natures of only two have been determined to date.
TRUSTED_SUSTAINABILITY

Spezifikation

Accession Number P26368
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11338
Name Human U2AF2 (aa 255-346) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 65 kDa; hU2AF(65); hU2AF65; splicing factor U2AF 65 kDa subunit; U2 (RNU2) small nuclear RNA auxiliary factor 2; U2 auxiliary factor 65 kDa subunit; U2 small nuclear ribonucleoprotein auxiliary factor (65 kD); U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2; U2 small nuclear ribonucleoprotein auxiliary factor (U2AF), 65 kDa; U2 small nuclear RNA auxiliary factor 2; U2 snRNP auxiliary factor large subunit; U2AF2; U2af65; Unknown (protein for MGC:137461)
Common Name U2AF2
Gene Symbol U2AF2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Mehr anzeigen Weniger anzeigen
Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt