Invitrogen™ Human TYW1 (aa 352-468) Control Fragment Recombinant Protein

Product Code. 30208352

Brand: Invitrogen™ RP90614

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53316 (PA5-53316. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TYW1, also known as TYW1A, RSAFD1 or YPL207W, is a 732 amino acid protein containing one flavodoxin-like domain that participates in the wybutosine-tRNA (Phe) biosynthesis pathway. Wybutosine (yW) is a hypermodified guanosine at the 3-prime position adjacent to the anticodon of phenylalanine tRNA that stabilizes codon-anticodon interactions during decoding on the ribosome. TYW1 is involved in a multistep enzymatic reaction that stabilizes codon-anticodon base-pairing during the ribosomal decoding process, thereby ensuring correct translation. TYW1 binds to one 4Fe-4S cluster and is located on human chromosome 7. Defects in some of the genes on chromosome 7 have been linked to Osteogenesis imperfecta, Williams-Beuren syndrome, Lissencephaly, Citrullinemia and Shwachman-Diamond syndrome, suggesting that TYW1 may play a role in these conditions.

Specifications

• Accession Number: Q9NV66
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55253
• Name: Human TYW1 (aa 352-468) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Radical S-adenosyl methionine and flavodoxin domain-containing protein 1; radical S-adenosyl methionine and flavodoxin domains 1; RGD1310420; RSAFD1; S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase; S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1; tRNA wybutosine-synthesizing protein 1 homolog; tRNA-yW synthesizing protein 1 homolog; tRNA-yW synthesizing protein 1 homolog (S. cerevisiae); tRNA-yW synthesizing protein 1 homolog A; tRNA-yW-synthesizing protein; TYW1; TYW1A; YPL207W
• Common Name: TYW1
• Gene Symbol: TYW1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RRAMITPALREALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKCVFCWRHHTNPVGTEWRWKMDQPEMILKEAIENHQNMIKQFKGVPGVKA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining