Invitrogen™ Human Tyrosinase (aa 498-529) Control Fragment Recombinant Protein

Product Code. 30212346

Brand: Invitrogen™ RP106318

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The enzyme encoded by this gene catalyzes the first 2 steps, and at least 1 subsequent step, in the conversion of tyrosine to melanin. The enzyme has both tyrosine hydroxylase and dopa oxidase catalytic activities, and requires copper for function. Mutations in this gene result in oculocutaneous albinism, and nonpathologic polymorphisms result in skin pigmentation variation. The human genome contains a pseudogene similar to the 3' half of this gene.

Specifications

• Accession Number: P14679
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7299
• Name: Human Tyrosinase (aa 498-529) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: albino; albino locus protein; ATN; C; CMM8; LB24-AB; monophenol monooxygenase; Oca1; OCA1A; OCAIA; oculocutaneous albinism IA; SHEP3; SK29-AB; skc35; Tumor rejection antigen AB; TYR; Tyrosinase; tyrosinase (oculocutaneous albinism IA); tyrosinase precursor
• Common Name: Tyrosinase
• Gene Symbol: TYR
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLCRHKRKQLPEEKQPLLMEKEDYHSLYQSHL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining