Invitrogen™ Human TXNRD3 (aa 73-149) Control Fragment Recombinant Protein

Product Code. 30200457

Brand: Invitrogen™ RP105917

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65167 (PA5-65167. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Displays thioredoxin reductase, glutaredoxin and glutathione reductase activities. Catalyzes disulfide bond isomerization. Promotes disulfide bond formation between GPX4 and various sperm proteins and may play a role in sperm maturation by promoting formation of sperm structural components.

Specifications

• Accession Number: Q86VQ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 114112
• Name: Human TXNRD3 (aa 73-149) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: TGR; Thioredoxin and glutathione reductase; thioredoxin glutathione reductase; thioredoxin reductase 2; thioredoxin reductase 3; Thioredoxin reductase TR2; TR2; TRXR3; TXNRD3
• Common Name: TXNRD3
• Gene Symbol: TXNRD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTVPNIFVNKVHVGGCDQTFQAYQSGLLQKLL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining