Invitrogen™ Human TXNL5 (aa 1-62) Control Fragment Recombinant Protein

Product Code. 30195667

Brand: Invitrogen™ RP93241

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54639 (PA5-54639. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TXNL5 disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.

Specifications

• Accession Number: Q9BRA2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 84817
• Name: Human TXNL5 (aa 1-62) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 14 kDa thioredoxin-related protein; 4831443O22Rik; D11Ertd672e; MGC14353; protein 42-9-9; putative 42-9-9 protein; testicular tissue protein Li 214; thioredoxin (Trx)-related protein, 14 kDa; thioredoxin domain containing 17; thioredoxin domain-containing protein 17; thioredoxin-like 5; thioredoxin-like protein 5; TRP14; Txndc17; Txnl5
• Common Name: TXNL5
• Gene Symbol: TXNDC17
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining