Invitrogen™ Human TXNDC9 (aa 154-226) Control Fragment Recombinant Protein

Product Code. 30205279

Brand: Invitrogen™ RP96023

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56876 (PA5-56876. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Not known. associated with cell differentiation. The protein encoded by this gene is a member of the thioredoxin family. The exact function of this protein is not known but it is associated with cell differentiation.

Specifications

• Accession Number: O14530
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10190
• Name: Human TXNDC9 (aa 154-226) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI098020; APACD; ATP binding protein; ATP binding protein associated with cell differentiation; ATP-binding protein associated with cell differentiation; ES cell-related protein; fb15e07; PHLP3; Protein 1-4; thioredoxin domain containing 9; thioredoxin domain-containing protein 9; TXNDC9; wu:fb15e07; zgc:55522
• Common Name: TXNDC9
• Gene Symbol: TXNDC9
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining