missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TXNDC5 (aa 248-333) Control Fragment Recombinant Protein

Product Code. 30212800
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212800

Brand: Invitrogen™ RP95032

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83241 (PA5-83241. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein-disulfide isomerase. Its expression is induced by hypoxia and its role may be to protect hypoxic cells from apoptosis. Two transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NBS9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81567
Name Human TXNDC5 (aa 248-333) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AL022641; ENDOPDI; endoplasmic reticulum protein ERp46; endoplasmic reticulum resident protein 46; endothelial protein disulphide isomerase; ER protein 46; ERp46; FLJ21353; FLJ90810; HCC2; HCC-2; MGC3178; PC-TRP; PDIA15; Plasma cell-specific thioredoxin-related protein; protein disulfide isomerase family A, member 15; STRF8; thiore; thioredoxin domain containing 5; thioredoxin domain containing 5 (endoplasmic reticulum); thioredoxin domain-containing protein 5; thioredoxin related protein; thioredoxin-like protein p46; Tlp46; TXNDC5; UNQ364; UNQ364/PRO700
Common Name TXNDC5
Gene Symbol Txndc5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TQHYELCSGNQVRGYPTLLWFRDGKKVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKGTVLALTENNFD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.