Invitrogen™ Human TXNDC11 (aa 723-817) Control Fragment Recombinant Protein

Product Code. 30182257

Brand: Invitrogen™ RP98731

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59467 (PA5-59467. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as a redox regulator involved in DUOX proteins folding. The interaction with DUOX1 and DUOX2 suggest that it belongs to a multiprotein complex constituting the thyroid H(2)O(2) generating system. It is however not sufficient to assist DUOX1 and DUOX2 in H(2)O(2) generation. [UniProt]

Specifications

• Accession Number: Q6PKC3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51061
• Name: Human TXNDC11 (aa 723-817) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810408E11Rik; AI427833; EF-hand binding protein 1; EF-hand-binding protein 1; EFP1; RGD1307538; thioredoxin domain containing 11; thioredoxin domain-containing protein 11; Txdc11; Txndc11
• Common Name: TXNDC11
• Gene Symbol: TXNDC11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PSLNHIFIQLARNLPMDTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCNRKDLSVKYPEDVPITLPNLLRFILHHSDPASSPQNVANSPTKECLQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining