Invitrogen™ Human TUT1 (aa 802-871) Control Fragment Recombinant Protein

Product Code. 30212442

Brand: Invitrogen™ RP107672

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation. TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]).[supplied by OMIM].

Specifications

• Accession Number: Q9H6E5
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64852
• Name: Human TUT1 (aa 802-871) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700038E08Rik; FLJ21850; FLJ22267; FLJ22347; MGC131987; MGC149809; nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpha regulated-poly(A) polymerase; nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase; PAP-associated domain-containing 2; PAPD2; poly(A) polymerase associated domain containing 2; RBM21; RNA binding motif protein 21; RNA uridylyltransferase; RNA-binding motif protein 21; RNA-binding protein 21; speckle targeted PIP5K1A-regulated poly(A) polymerase; STARPAP; Star-PAP; terminal uridylyl transferase 1 U6 snRNA-specific; terminal uridylyl transferase 1, U6 snRNA-specific; Tut1; TUTase; TUTase 6; TUTase6; U6 snRNA-specific terminal uridylyltransferase 1; U6 snRNA-specific terminal uridylyltransferase 1; speckle targeted PIP5K1A-regulated poly(A) polymerase; U6 TUTase; U6-TUTase; up-regulated in lung cancer 6; URLC6
• Common Name: TUT1
• Gene Symbol: TUT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPADRMLTVTPLQDPQGLFPDLHHFLQVFLPQAIR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining