missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TUSC5 (aa 6-99) Control Fragment Recombinant Protein

Product Code. 30197508
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197508

Brand: Invitrogen™ RP100272

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62253 (PA5-62253. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TUSC5 (tumor suppressor candidate 5), also known as protein located at seventeen-p-thirteen point three 1, LOST1 or IFITMD3 (interferon-induced transmembrane domain-containing protein D3), is a 177 amino acid multi-pass membrane protein that belongs to the CD225 family. Thought to play a role in fat metabolism, TUSC5 is highly expressed in mammary gland, heart, smooth muscle, skeletal muscle and stomach, with lower levels found in lung and brain.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IXB3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 286753
Name Human TUSC5 (aa 6-99) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BEC-1; brain endothelial cell-derived protein 1; C130069F04Rik; Dispanin subfamily B member 1; DSPB1; IFITMD3; interferon induced transmembrane protein domain containing 3; interferon-induced transmembrane domain-containing protein D3; located at seventeen p thirteen point three 1; Lost1; Protein located (at seventeen-p-thirteen point three 1; Trafficking regulator of GLUT4 1; Trarg1; Tumor suppressor candidate 5; tumor suppressor candidate 5 homolog; Tusc5)
Common Name TUSC5
Gene Symbol TUSC5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QSEFPSAQEPGSAAFLDLPEMEILLTKAENKDDKTLNLSKTLSGPLDLEQNSQGLPFKAISEGHLEAPLPRSPSRASSRRASSIATTSYAQDQE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.