Invitrogen™ Human TUSC3 (aa 41-77) Control Fragment Recombinant Protein

Product Code. 30204281

Brand: Invitrogen™ RP103752

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62109 (PA5-62109. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Made up of nearly 146 million bases, chromosome 8 encodes about 800 genes. Translocation of portions of chromosome 8 with amplifications of the c-Myc gene are found in some leukemias and lymphomas, and typically associated with a poor prognosis. Portions of chromosome 8 have been linked to schizophrenia and bipolar disorder. Trisomy 8, also known as Warkany syndrome 2, most often results in early miscarriage but is occasionally seen in a mosaic form in surviving patients who suffer to a varying degree from a number of symptoms including retarded mental and motor development, and certain facial and developmental defects. WRN is a DNA helicase encoded by chromosome 8 and shown defective in those with the early aging disorder Werner syndrome. Chromosome 8 is also associated with Pfeiffer syndrome, congenital hypothyroidism and Waardenburg syndrome.

Specifications

• Accession Number: Q13454
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7991
• Name: Human TUSC3 (aa 41-77) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AU022242; BC003311; D8S1992; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit TUSC3; M33; Magnesium uptake/transporter TUSC3; MGC13453; MRT22; MRT7; N33; Oligosaccharyl transferase subunit TUSC3; oligosaccharyltransferase 3 homolog A; OST3A; Protein N33; Putative prostate cancer tumor suppressor; tumor suppressor candidate 3; Tusc3
• Common Name: TUSC3
• Gene Symbol: TUSC3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GQKKKENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining