missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TUSC2 (aa 4-106) Control Fragment Recombinant Protein

Product Code. 30202616
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202616

Brand: Invitrogen™ RP95276

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110993 (PA5-110993. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TUSC2 (tumor suppressor candidate 2), also known as FUS1, LGCC or PDAP2, is a 110 amino acid protein that is expressed at high levels in kidney, pancreas, lung, heart and skeletal muscle where it is thought to function as a tumor suppressor. More specifically, TUSC2 inhibits invasive colony formation by inducing G1 cell cycle arrest and ultimately causing apoptosis, thereby preventing tumor growth. The gene encoding TUSC2 maps to human chromosome 3, which houses over 1,100 genes, including a chemokine receptor (CKR) gene cluster and a variety of human cancer-related gene loci. Key tumor suppressing genes on chromosome 3 include those that encode the apoptosis mediator RASSF1, the cell migration regulator HYAL1 and the angiogenesis suppressor SEMA3B.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75896
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11334
Name Human TUSC2 (aa 4-106) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190001E22Rik; AA407686; C3orf11; Fus1; Fus-1 protein; Fusion 1 protein; Lgcc; lung cancer candidiate, FUS; PAP; PDAP2; PDGFA associated protein 2; PDGFA-associated protein 2; Tumor suppressor candidate 2; TUSC 2; Tusc2
Common Name TUSC2
Gene Symbol TUSC2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.