Invitrogen™ Human TUFM (aa 362-455) Control Fragment Recombinant Protein

Product Code. 30209730

Brand: Invitrogen™ RP92516

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82652 (PA5-82652. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy. A pseudogene has been identified on chromosome 17.

Specifications

• Accession Number: P49411
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7284
• Name: Human TUFM (aa 362-455) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2300002G02Rik; C76308; C76389; COXPD4; D250; EFTU; EF-Tu; EF-TuMT; elongation factor Tu; elongation factor Tu, mitochondrial; fi06f04; P43; Tu translation elongation factor, mitochondrial; TUFM; tufm {ECO:0000250; UniProtKB:P49411}; wu:fi06f04; zgc:110766
• Common Name: TUFM
• Gene Symbol: TUFM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAMTEEEKNIKWG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining