Invitrogen™ Human TTLL7 (aa 783-878) Control Fragment Recombinant Protein

Product Code. 30202731

Brand: Invitrogen™ RP106926

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66247 (PA5-66247. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Polyglutamylase which preferentially modifies beta-tubulin (PubMed:25959773). Mediates both ATP-dependent initiation and elongation of polyglutamylation of microtubules (PubMed:25959773). Required for neurite growth; responsible for the strong increase in tubulin polyglutamylation during postnatal neuronal maturation. [UniProt]

Specifications

• Accession Number: Q6ZT98
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79739
• Name: Human TTLL7 (aa 783-878) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110049N09Rik; 4921517B04Rik; C630030B20; mTTLL7; RP5-836J3.2; Testis development protein NYD-SP30; TTLL7; Tubulin polyglutamylase TTLL7; tubulin tyrosine ligase like 7; tubulin tyrosine ligase-like family member 7; tubulin tyrosine ligase-like family, member 7; tubulin--tyrosine ligase-like protein 7
• Common Name: TTLL7
• Gene Symbol: TTLL7
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WNCFCDSGSSWESIFNKSPEVVTPLQLQCCQRLVELCKQCLLVVYKYATDKRGSLSGIGPDWGNSRYLLPGSTQFFLRTPTYNLKYNSPGMTRSNV
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining