missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30211245

Invitrogen™ Human TTLL12 (aa 507-636) Control Fragment Recombinant Protein

Product Code. 30211245
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211245

Brand: Invitrogen™ RP91500

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51810 (PA5-51810. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TTLL12 (tubulin tyrosine ligase-like family, member 12) is a 644 amino acid protein that contains one TTL domain. Of the fourteen members of the TTLL family that modify tubulin, TTLL12 is the least characterized member. TTLL12 is highly expressed in a multitude of metastatic prostate cancer cell lines, therefore, it is considered a target for tumor therapy. Overexpression of TTLL12 is suggested to alter chromosome ploidy, whereas downregulation of TTLL12 influence several post-translational modifications of tubulin.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14166
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23170
Name Human TTLL12 (aa 507-636) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BC055368; D430005B17; dJ526I14.2; Inactive tubulin--tyrosine ligase-like protein 12; KIAA0153; RGD1305319; TTL domain protein; ttll12; tubulin tyrosine ligase like 12; tubulin tyrosine ligase-like family member 12; tubulin tyrosine ligase-like family, member 12; tubulin--tyrosine ligase-like protein 12
Common Name TTLL12
Gene Symbol TTLL12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DYEKHFTVMNYDPDVVLKQVHCEEFIPEFEKQYPEFPWTDVQAEIFRAFTELFQVACAKPPPLGLCDYPSSRAMYAVDLMLKWDNGPDGRRVMQPQILEVNFNPDCERACRYHPTFFNDVFSTLFLDQPG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.