Invitrogen™ Human TTC39B (aa 124-201) Control Fragment Recombinant Protein

Product Code. 30212444

Brand: Invitrogen™ RP107216

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66561 (PA5-66561. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulates high density lipoprotein (HDL) cholesterol metabolism by promoting the ubiquitination and degradation of the oxysterols receptors LXR (NR1H2 and NR1H3). [UniProt]

Specifications

• Accession Number: Q5VTQ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 158219
• Name: Human TTC39B (aa 124-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1810054D07Rik; 9130422G05Rik; AI450603; AV103077; AW215585; C9orf52; T39; tetratricopeptide repeat domain 39 B; tetratricopeptide repeat protein 39 B; TPR repeat protein 39 B; Ttc39b
• Common Name: TTC39B
• Gene Symbol: TTC39B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSSSTKVDLKSGLEECAVALNLFLSNKFTDALELLRPWAKESMYHALGYSTIVVLQAVLTFEQQDIQNGISAMKDALQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining