Invitrogen™ Human TTC30A (aa 447-536) Control Fragment Recombinant Protein

Product Code. 30210652

Brand: Invitrogen™ RP104467

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62465 (PA5-62465. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q86WT1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92104
• Name: Human TTC30A (aa 447-536) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: IFT70A; tetratricopeptide repeat domain 30 A; tetratricopeptide repeat domain 30 B; tetratricopeptide repeat protein 30 A; TPR repeat protein 30 A; TTC30A
• Common Name: TTC30A
• Gene Symbol: TTC30A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FRKSVEFCNDHDVWKLNVAHVLFMQENKYKEAIGFYEPIVKKHYDNILNVSAIVLANLCVSYIMTSQNEEAEELMRKIEKEEEQLSYDDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining