Invitrogen™ Human TTC23 (aa 337-432) Control Fragment Recombinant Protein

Product Code. 30181151

Brand: Invitrogen™ RP98041

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58937 (PA5-58937. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Participates positively in the ciliary Hedgehog (Hh) signaling. [UniProt]

Specifications

• Accession Number: Q5W5X9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64927
• Name: Human TTC23 (aa 337-432) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600012K10Rik; Cervical cancer proto-oncogene 8 protein; HCC8; HCC-8; RGD1310409; tetratricopeptide repeat domain 23; tetratricopeptide repeat protein 23; TPR repeat protein 23; TTC23
• Common Name: TTC23
• Gene Symbol: TTC23
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining